Protein Info for HER17_RS05860 in Pectobacterium carotovorum WPP14

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 765 transmembrane" amino acids 214 to 236 (23 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details amino acids 467 to 487 (21 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 66 to 760 (695 residues), 982 bits, see alignment E=8.3e-300 PF00664: ABC_membrane" amino acids 219 to 477 (259 residues), 72.2 bits, see alignment E=5.8e-24 PF00005: ABC_tran" amino acids 547 to 696 (150 residues), 110.7 bits, see alignment E=9.1e-36

Best Hits

KEGG orthology group: K12541, ATP-binding cassette, subfamily C, bacterial LapB (inferred from 96% identity to pct:PC1_3062)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (765 amino acids)

>HER17_RS05860 type I secretion system permease/ATPase (Pectobacterium carotovorum WPP14)
MKLHSVQETNGSDKSVAQESIVQEPAVHESTGVHESTIAHEPIVHEPIFHESIIHEHSDP
RSRHDDPLLDSLLILCTLQGKSVSRTTLTAGLPLANQRLSVKLLPRAAARAGLQGRVLKR
SLNKISEMSLPAMLLLREGRAAILLGWNADGSARLMPSETEGGEISVEHNTLQQNYLGLV
MFAQPRHQFDLQNPSLIPRTKSWFKDTLKLSRSLYLDAVLASLLVNIIALATPLFVMNVY
DRVVPNQATATLWVLAIGVTGAFVFDLILKTLRGICLDMAGKKTDLIISATLFERITGMS
MKARPPRVGSFAQNIHEFQSLRDFLSSLTLTTLIDFPFTLLLLLVIGIIGGPLVWVSILA
YPIALLASWAMQKPLSATIEKTMHLASERQATLIETLSCLDAIKVNNAESERQHQWEQTI
GSLSKLEMRAKALSSLAVNLTQWFQQFAGVAMIVVGVYMLINGKLSMGGLIACYMLNGRA
LMPLGQLSGLVSRYQQARLTMQTTEQMMQLPQERSDNERPLKRESIRGGIEFRDVTFNYP
EQKTSSLQGISLTIAPGEKVGVIGRSGSGKSSLQKLIVNLYQPNTGNILIDGVDARQLDV
SDLRHNIGYVPQDIQLFSGSLRNNLISGARYVEDEAMLRAAEISGVNEFARLHPDGYNLQ
VGERGQQLSGGQRQAVAIARALLLDPPILVLDEPTSSMDNTSEDRLKQALAPVIAEKTLL
LVTHRVSMLALVDRLVIVDRGKIIADGPKAIVMDALKKGQINASR