Protein Info for HER17_RS05855 in Pectobacterium carotovorum WPP14

Annotation: HlyD family type I secretion periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 42 to 60 (19 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 38 to 453 (416 residues), 439.6 bits, see alignment E=6.1e-136 PF13533: Biotin_lipoyl_2" amino acids 80 to 116 (37 residues), 35.3 bits, see alignment 1.2e-12 PF13437: HlyD_3" amino acids 305 to 417 (113 residues), 59.8 bits, see alignment E=5.8e-20

Best Hits

KEGG orthology group: K12542, membrane fusion protein LapC (inferred from 97% identity to pct:PC1_3063)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>HER17_RS05855 HlyD family type I secretion periplasmic adaptor subunit (Pectobacterium carotovorum WPP14)
MRLGKYIKRIKRYFVGGDEESLQTMPEVSRAMAEDSPRSIRFTLWAIGAFFLFFILWAGL
ANIDEVTRGDGKAIPSSRLQKIQNLEGGIITEVFIREGQVVNAGDPLLRLDDTRFASNVG
ETEADRLALLSRIERLNAEINGQELVLSEEITTQAPKIAAGEKELYNSRRQQLHNEISGL
EEQLIQRQQELRDFSAKEIQFRNSLGLLQQEIKMSEPLIAEGAISKVEVLRLRRAEVETR
GQLDSIKLSIPRAESAIKESENKIEETRSRYKSEALSQLSEAQTSLNKIEATGKALEDRV
NRTLVVSPVRGIVQQVLVNTIGGVIQPGSDLVEIVPLDDKLLVEAKIRPQDIAFLHPGQD
AIIKLTAYDYTIYGGLKGQLEQISPDTVTDKEGNSFYIIRLRTDKNYLGSADKPLLIIPG
MVASVDIITGKKTILSYLLKPIIRANAEALRER