Protein Info for HER17_RS05680 in Pectobacterium carotovorum WPP14

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 204 to 230 (27 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 22 to 275 (254 residues), 320.4 bits, see alignment E=1e-99 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 22 to 277 (256 residues), 382.7 bits, see alignment E=8.9e-119 PF00528: BPD_transp_1" amino acids 83 to 279 (197 residues), 63.1 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 50% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 99% identity to pct:PC1_3092)

MetaCyc: 50% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>HER17_RS05680 sulfate ABC transporter permease subunit CysW (Pectobacterium carotovorum WPP14)
MEQVISAQAGAAKRKKQPAAYYILVSLAWVVFFLILVLPLMMVVTQGLDKGVGAFWDAIT
EPDAISALKLTLLATVISVPLNVVFGLATAWCVTKFEFRGKSFLLALIDLPFSVSPVVAG
LVYVLLFGAQSKIYPFLLEHDLQIVYAVPGIVLATIFVTLPYVARELIPLMEEQGSQEEE
AARLLGANGWQMFWHITLPNVKWALIYGVVLCTARAMGEFGAVSVISGHIRGLTNTLPLH
IEILYNEYNIVAAFSVAILLLIMSLVVLLLRQWSESRLTKQIEKQQELAKNEH