Protein Info for HER17_RS05050 in Pectobacterium carotovorum WPP14
Annotation: recombination regulator RecX
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 88% identical to RECX_PECAS: Regulatory protein RecX (recX) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K03565, regulatory protein (inferred from 94% identity to pct:PC1_3212)Predicted SEED Role
"Regulatory protein RecX"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (164 amino acids)
>HER17_RS05050 recombination regulator RecX (Pectobacterium carotovorum WPP14) MNKPLRYAMNVLSVRDYSETEIRRKCAAYLYKSESAKAEDEADEATARAAAEDVEAAIAY CKEHGWLDDERYARRYISSRSRKGYGAQRIKMELSQKGIDKTTLATALNESDIDWCALAK SVVERKFGHPLSDEWKDKVKHQRYLLYRGFFHEEIQSIYTNFSD