Protein Info for HER17_RS04885 in Pectobacterium carotovorum WPP14

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 865 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 853 (841 residues), 1163.3 bits, see alignment E=0 PF00004: AAA" amino acids 219 to 331 (113 residues), 32.5 bits, see alignment E=3.9e-11 amino acids 608 to 725 (118 residues), 26.5 bits, see alignment E=2.8e-09 PF17871: AAA_lid_9" amino acids 359 to 459 (101 residues), 100.8 bits, see alignment E=1.4e-32 PF07724: AAA_2" amino acids 602 to 763 (162 residues), 172.2 bits, see alignment E=3.5e-54 PF07728: AAA_5" amino acids 607 to 725 (119 residues), 40.8 bits, see alignment E=7.8e-14 PF10431: ClpB_D2-small" amino acids 769 to 842 (74 residues), 34.9 bits, see alignment E=4.5e-12

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 97% identity to eca:ECA3436)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (865 amino acids)

>HER17_RS04885 type VI secretion system ATPase TssH (Pectobacterium carotovorum WPP14)
MIRIELPTLVERLNPVCRHMLEEAAALCIQHQGAEIRIEHLLLKMLETPLCDVRQILKRA
GVDADELSSLLLPSSMDKEFDAGYPSFSPLLVEWLQDSWLLASAEFQHVRLRSGILLLVL
LLTPNRYVAGAVSRPLAQINRELLRQQFDEWVKDSVETEVAVQSATAEQAAAANTQLSRY
TQNVTESARQGQLDPVLCRDHEIDLMIDILSRRRKNNPIVVGEAGVGKSALIEGLALRIV
AGAVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVMQEVKDSPRPIILFIDEAHTLI
GAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRFQLVKVGEPNAE
EATVILRGLRGIYEKAHGVLIDEDALQAAAQLSARYISGRQLPDKAIDVLDTASARVAIN
LTTPPRAVSQLQTRLHQQEMEITQLERQARIGLGNTEERLAELRDAREAGAVQLAQLEAD
WQQQKTQVQRVIELRTALLDEEQSVDFDAVSAAAELATCEQALEALQQSSVLVSPHVDKT
QIAAVIAEWTGVPLNRISQSEMDVVTRLPEFLGDLIKGQQLAIAHLHKHLLTARADLRRP
GRPLGAFLLVGPSGVGKTETVLQIADLMFGGRNYLTTINMSEYQEKHTVSRLIGSPPGYV
GFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRVIDCRNVVF
FLTSNLGFQTIVNYAEQSDVLLDALYPELAAFFKPALLARMEVIPYLPLAHDTMVEIVQG
KLSRLVSLLQQRFGAEVIIEDEVPEEILRLANRSENGARMLESVIDGALLPPVSLQLLQR
MSAGEPVSRIHFRVEAGQFQTEVEG