Protein Info for HER17_RS04580 in Pectobacterium carotovorum WPP14

Annotation: methylthioribulose 1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 9 to 195 (187 residues), 151.9 bits, E=9.6e-49
• TIGR03328: methylthioribulose-1-phosphate dehydratase
  • amino acids 11 to 199 (189 residues), 244.7 bits, E=2.7e-77

Best Hits

Swiss-Prot: 100% identical to MTNB_PECCP: Methylthioribulose-1-phosphate dehydratase (mtnB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 97% identity to eca:ECA3487)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Protein Sequence (205 amino acids)

>HER17_RS04580 methylthioribulose 1-phosphate dehydratase (Pectobacterium carotovorum WPP14)
MTENQQLTALLAACHWIGEKGWCPATGGNMSVRLDEAQCLITESGKDKGSLQAEDFLLVE
IATNHVPSGRTPSAETGLHTLLYRREPTIGAVLHTHSVNATVLSRVEKGAELVLHGYEMQ
KSLAGQTTHLDRVAIPIFDNDQDIPALAQRVTEYASHTPLRYGFLVRGHGLYCWGATVKE
ARRHLEGLEFLFQCELQRRLLEAKA