Protein Info for HER17_RS04325 in Pectobacterium carotovorum WPP14

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01128: IspD
  • amino acids 11 to 234 (224 residues), 270.3 bits, E=1.4e-84
• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 12 to 233 (222 residues), 244.2 bits, E=5.3e-77
• PF12804: NTP_transf_3
  • amino acids 13 to 186 (174 residues), 44.8 bits, E=1.6e-15

Best Hits

Swiss-Prot: 96% identical to ISPD_PECCP: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 96% identity to pct:PC1_3353)

MetaCyc: 66% identical to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase. [EC: 2.7.7.60]

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• isoprene biosynthesis I (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Protein Sequence (237 amino acids)

>HER17_RS04325 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Pectobacterium carotovorum WPP14)
MQTPRLSPPDIVAVLPAAGNGSRMQNDRPKQYLTIGNDATGHKTILEHTIDALLRHSRVQ
RVVVVISPDDAFFHTLAIANDPRICAVTGGQQRADSVLAGLAAVADSAWALVHDAARPCL
HQDDLTRLLAIVEQSDVGGILAAPVRDTMKRGTDGFIDRTVERNDLWHALTPQLFPAALL
KQCLQRALQDGVAVTDEASALEYCGYRPQIISGRSDNIKVTRPEDLALAEFYLTSLQ