Protein Info for HER17_RS03905 in Pectobacterium carotovorum WPP14

Annotation: 50S ribosomal protein L9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00158: ribosomal protein bL9
  • amino acids 1 to 149 (149 residues), 193.7 bits, E=1.2e-61
• PF01281: Ribosomal_L9_N
  • amino acids 1 to 45 (45 residues), 77.6 bits, E=4.2e-26
• PF03948: Ribosomal_L9_C
  • amino acids 63 to 148 (86 residues), 89.4 bits, E=1.7e-29

Best Hits

Swiss-Prot: 100% identical to RL9_PECCP: 50S ribosomal protein L9 (rplI) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 100% identity to pct:PC1_3432)

MetaCyc: 89% identical to 50S ribosomal subunit protein L9 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Protein Sequence (150 amino acids)

>HER17_RS03905 50S ribosomal protein L9 (Pectobacterium carotovorum WPP14)
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVEFFEARRAELEAKLAD
VLAAAEARAAKIKELGSVTIASKAGDEGKLFGSIGTRDIADAVTAAGVDIAKSEVRLPNG
VLRTLGEHEVSFQVHSDVFAELNVVVVAEA