Protein Info for HER17_RS03515 in Pectobacterium carotovorum WPP14

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 121.5 bits, see alignment E=6.4e-39 PF17912: OB_MalK" amino acids 235 to 284 (50 residues), 41.6 bits, see alignment 2.9e-14 PF08402: TOBE_2" amino acids 278 to 349 (72 residues), 34.1 bits, see alignment E=3.5e-12

Best Hits

Swiss-Prot: 55% identical to UGPC_RUEPO: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 98% identity to eca:ECA3748)

MetaCyc: 58% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>HER17_RS03515 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Pectobacterium carotovorum WPP14)
MASLELKNVHKSYGAVSIIKGVDLTIHDGEFMVFVGPSGCGKSTLLRMIAGLEEISSGEL
WIDNRKVNDLTPAERKIAMVFQSYALYPHLSVRKNLAFGLENLHFPKDEIIRRIDEAARM
LGLEPYLDRRPRALSGGQQQRVAIGRAIVREPDLFLFDEPLSNLDAKLRVQTRGELSRLH
QKLRTTMIYVTHDQVEAMTMAQRIVVLNAGRIEQVGTPLELFNRPKNKFVAGFIGSPRMN
MFPAQIVATCADGVEVQCPSGNRLVLPFIGTVGQNVTLGIRPSHCELVEEGEGIALCVDR
CEMMGHETFIYGRMGGIDDEMIVHLAQHREFATGESVFVRFPPTYCHLFDGKTDDTLPRC
TKH