Protein Info for HER17_RS03000 in Pectobacterium carotovorum WPP14

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 290 to 313 (24 residues), see Phobius details PF02743: dCache_1" amino acids 58 to 267 (210 residues), 47.1 bits, see alignment E=2.2e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 363 to 520 (158 residues), 150.8 bits, see alignment E=1.5e-48 PF00990: GGDEF" amino acids 365 to 517 (153 residues), 140.6 bits, see alignment E=4e-45

Best Hits

KEGG orthology group: None (inferred from 94% identity to pct:PC1_3627)

Predicted SEED Role

"HmsT protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (526 amino acids)

>HER17_RS03000 sensor domain-containing diguanylate cyclase (Pectobacterium carotovorum WPP14)
MFFKLLNHFGLRRLILLLAVASALVTLANSFYASYRVQRELLIDNTLEANRVYATKLAAM
THSFFKESQQQLAYSATIVATQMDDKASLFKEADRLRLQTSHFNSVVIADEKGIVRATSP
DTFQLIGRSLTTEGALEALKEKQPLISQPYVSAANNLIVLISSPIFTRDGRYKGFIGGSI
YLKQPSVLNTLLDKHYYRDGSYIYVTDKNKKMLYHRDMERIGKTETNNLKIDAYHENNGS
QHMVNYLGETMLAGYAVEATSQWQIVALRPIDITLKPLDSLMLNVLRHTLPLALLTIFCV
WLLARLIAQPLWLLARSANKMDATDVSDDIRNIHSWYFEASQLKQAMLLGIDLLQRKIGK
LRSEAHSDPMTELLNRRGLDSVLRYWQMGQKSFAVIALDIDRFKRINDTHGHDVGDNVIR
YLSQLIRTSSRDADILCRSGGEEFLILLPETSLDVALSIAERLRQRVQESTIPVVGNITI
SLGVALWEPGVSDMPIDRTFKLADEALYQAKQEGRNRVVSASGSEQ