Protein Info for HER17_RS02980 in Pectobacterium carotovorum WPP14

Annotation: co-chaperone DjlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05099: TerB
  • amino acids 64 to 170 (107 residues), 29.1 bits, E=1e-10
• PF00226: DnaJ
  • amino acids 234 to 293 (60 residues), 36.2 bits, E=5.4e-13

Best Hits

Swiss-Prot: 93% identical to DJLA_PECAS: Co-chaperone protein DjlA (djlA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 94% identity to pct:PC1_3631)

Predicted SEED Role

"DnaJ-like protein DjlA"

Protein Sequence (296 amino acids)

>HER17_RS02980 co-chaperone DjlA (Pectobacterium carotovorum WPP14)
MRYWGKLLGLALGIVSSAGIWGMIMGLLMGHWIDKARASRRRDYFSAQSTRQSLFFLTTF
QAMGHLTKSKGRVTEADIKIATKMMDRLELFGEARTAAQRAFREGKTSHFPLRIKLRKLR
DACLGRFDLIKMFLEIQLQVAFVDGVLHPNERRVLYVIADELGVTREQFEFFLRNMESTT
GQQSRQNQSRQNGKSHQRRSNGHSSGGYSNGHSYGGQRPASPPRGPTVESACRTLGVRSS
DDAVTIKRAYRKLMNEHHPDKLVAKKLSPRMMEMAKRKAQDIQAAYELLKSANQTK