Protein Info for HER17_RS02875 in Pectobacterium carotovorum WPP14

Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 2 to 160 (159 residues), 183.7 bits, see alignment E=1.3e-58 PF01252: Peptidase_A8" amino acids 15 to 157 (143 residues), 142.6 bits, see alignment E=5.2e-46

Best Hits

Swiss-Prot: 82% identical to LSPA_ECO5E: Lipoprotein signal peptidase (lspA) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 98% identity to pwa:Pecwa_3845)

MetaCyc: 82% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>HER17_RS02875 signal peptidase II (Pectobacterium carotovorum WPP14)
MMNKICSSGLRWLWLAILVLIVDLGSKQWILAHFALGDTVPVMPSLNLHYARNYGAAFSF
LADKGGWQRWFFAGIAIAIVVALLVMMYRGSVKQRLNNIAYSLIIGGALGNLFDRTWHGF
VVDFIDFYVGDWHFATFNLADTAICIGAALIVLEGFFSTHDDTDTVKQKGH