Protein Info for HER17_RS02815 in Pectobacterium carotovorum WPP14

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 4 to 316 (313 residues), 546.8 bits, E=8.6e-169
• PF00923: TAL_FSA
  • amino acids 14 to 313 (300 residues), 323.8 bits, E=5e-101

Best Hits

Swiss-Prot: 99% identical to TAL2_PECAS: Transaldolase 2 (tal2) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 99% identity to eca:ECA3887)

MetaCyc: 90% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• Bifidobacterium shunt (12/15 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.2

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (317 amino acids)

>HER17_RS02815 transaldolase (Pectobacterium carotovorum WPP14)
MTDKLTSLRQLTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQIPEYRKLIDEAIAWAR
EQSSDRKQQVVDATDKLAVNIGLEILKLIPGRISTEVDARLSYDTEASVAKAKHLIKLYN
DAGISNERILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQARACAEAGVFLISPFVG
RILDWYKANGDKKEFAPHEDPGVVSVSEIYDYYKEHGYETVVMGASFRNVGEILELAGCD
RLTIAPALLKELSESEGEVVRKLSYVGDVKVRPAKMTEAEFYWQHNQDPMAIDKLADGIR
KFAIDQEKLEKMIADLL