Protein Info for HER17_RS02480 in Pectobacterium carotovorum WPP14

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details PF01810: LysE" amino acids 14 to 200 (187 residues), 121.1 bits, see alignment E=2.1e-39

Best Hits

KEGG orthology group: None (inferred from 94% identity to eca:ECA3951)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>HER17_RS02480 LysE family translocator (Pectobacterium carotovorum WPP14)
MNELIAVATITILAVISPGPDFAMVTRNSYAFGSRAGLFSAFGIACGVQIHVMYTVFGIA
VFIVNSPMIFMAMKVLGASYLIYLGYKSLTNTTKIKLEEASGNAPSSLAVFRMGFLTNAL
NPKTMLFVVATYTQVVQPGSPMGHNFGYGLFMSVAHWVWFSIVALFFAAPAMRRRLIDRQ
HWVDKGIGVALIALGASLALTKITL