Protein Info for HER17_RS02470 in Pectobacterium carotovorum WPP14

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 200 to 226 (27 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 352 to 352 (1 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 178 (163 residues), 47.9 bits, see alignment E=1.4e-16 amino acids 207 to 370 (164 residues), 62.9 bits, see alignment E=4e-21 PF06779: MFS_4" amino acids 32 to 371 (340 residues), 27 bits, see alignment E=4.5e-10

Best Hits

KEGG orthology group: None (inferred from 94% identity to pct:PC1_3745)

Predicted SEED Role

"FIG00906007: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>HER17_RS02470 MFS transporter (Pectobacterium carotovorum WPP14)
MTAHARESNFTTLNMIIAASLVGLVTGYTLPLISLKLAEHGHSTATLGILAALPAAGMML
SSFVTPWLSRHLHASYLLSGSLIILAASTVASFLLSHPVSLILPRLLTGLASGVLVVLGE
TWVTSRASDKHKATLTGLYASVFTGCQLIGPLLIAAGEPIQIYALWLICGISAACAFMLR
NCASMVRADEQSSTSYRDLIPFLPAIASGVLCFSFFDASILALFPLYGMEQGLDEKSAIL
LVTLIFLGDAVFQTPIGWLADKCGIIKTHISCGILFCVMLILITFSFSSPALLVPVCIVL
GAAAGGLYTLSLVRAGQKFAGQRLIVMNSLLGLVWSAGSISGPLFSGAAITFYGYDGLIA
ILLLTGVLFVGIQGVLRKERVSRSLGEE