Protein Info for HER17_RS02445 in Pectobacterium carotovorum WPP14

Annotation: YjjG family noncanonical pyrimidine nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02254: noncanonical pyrimidine nucleotidase, YjjG family
  • amino acids 3 to 224 (222 residues), 207.5 bits, E=1.8e-65
• PF00702: Hydrolase
  • amino acids 3 to 191 (189 residues), 59.6 bits, E=8.3e-20
• PF13419: HAD_2
  • amino acids 7 to 199 (193 residues), 49.2 bits, E=1.1e-16
• PF13242: Hydrolase_like
  • amino acids 154 to 221 (68 residues), 36.4 bits, E=5.9e-13

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 96% identity to pct:PC1_3750)

Predicted SEED Role

"5'-nucleotidase YjjG (EC 3.1.3.5)" (EC 3.1.3.5)

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• ureide biosynthesis (4/7 steps found)
• 2-chloroacrylate degradation I (1/3 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• NAD salvage (plants) (5/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• superpathway of purines degradation in plants (8/18 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5 or 3.8.1.2

Protein Sequence (231 amino acids)

>HER17_RS02445 YjjG family noncanonical pyrimidine nucleotidase (Pectobacterium carotovorum WPP14)
MKYRHFLFDLDDTLLDFKASERLSFARTLTNLGVDIENTTLFADYQRENSQLWSEFEKGE
ITKDLLKVERFRRTFSLHGIDIDPHKASNLYLECLPETVVLVDGAVQICEALAEIGEVGI
ITNGIEYVQAKRVANSGLADWLSFVATSEACGFAKPDARFFEFSASKFSSFKKAEAVIVG
DRLDADILGANLYGIDSCWFNAGGAANDSDIAPTYEAATLQDVFTQISARS