Protein Info for HER17_RS02380 in Pectobacterium carotovorum WPP14

Annotation: fumarate reductase subunit FrdC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details PF02300: Fumarate_red_C" amino acids 3 to 128 (126 residues), 179.5 bits, see alignment E=1.4e-57

Best Hits

Swiss-Prot: 75% identical to FRDC_YERE8: Fumarate reductase subunit C (frdC) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K00246, fumarate reductase subunit C (inferred from 96% identity to pct:PC1_3760)

MetaCyc: 75% identical to fumarate reductase membrane protein FrdC (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit C" in subsystem Succinate dehydrogenase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (131 amino acids)

>HER17_RS02380 fumarate reductase subunit FrdC (Pectobacterium carotovorum WPP14)
MTSKRKAYVRGMSPTWWKKLGFYRFYMLREGTAVPAVWFSIVLMFGVFALKNGPEGWANF
VSFLQNPLVLLINIVALLAAALHTKTWFELAPKASIIVIKDEKMGPEPIIKGLWAVTVVV
TVAVLAIALLF