Protein Info for HER17_RS01890 in Pectobacterium carotovorum WPP14

Annotation: polysaccharide lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00544: Pectate_lyase_4" amino acids 71 to 278 (208 residues), 296.3 bits, see alignment E=1.3e-92 PF13229: Beta_helix" amino acids 102 to 236 (135 residues), 27.2 bits, see alignment E=2.9e-10

Best Hits

Swiss-Prot: 100% identical to PLY3_PECCC: Pectate lyase 3 (pel3) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K01728, pectate lyase [EC: 4.2.2.2] (inferred from 98% identity to pwa:Pecwa_4037)

MetaCyc: 76% identical to pectate lyase C (Dickeya dadantii 3937)
Pectate lyase. [EC: 4.2.2.2]

Predicted SEED Role

"Pectate lyase 1 precursor (EC 4.2.2.2) (Pectate lyase I) (PEL I) (PLA)" (EC 4.2.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.2.2

Use Curated BLAST to search for 4.2.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>HER17_RS01890 polysaccharide lyase (Pectobacterium carotovorum WPP14)
MKYLLPSAAAGLLLLAAQPTMAANTGGYATTDGGDVAGAVKKTARSMQDIIDIIEAAKLD
SNGKKVKGGAYPLVITYNGNEDALIKAAENDICGQWKKDARGVEIKEFTKGITIIGTNGS
SANFGIWLTKSSDIVIRNMRFGYMPGGAQDGDAIRIDNTPNVWIDHNEIFAKNFECAGTK
DGDTTFESAIDIKKASTNVTVSYNYIHGIKKVGLSGFSSSDTGRDLTYHHNIYDDVNARL
PLQRGGQVHAYNNLYTGITSSGLNVRQKGIALIERNWFENAKNPVTSRYDGSNFGTWELR
NNNVMSPADFAKYNITWDKDTKPYVNAEDWKSTGTFASVPYSYSPVSAQCVKDKLANYAG
VNKNLAVLTAANCN