Protein Info for HER17_RS01770 in Pectobacterium carotovorum WPP14

Annotation: DNA uptake porin HofQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02515: type IV pilus secretin PilQ" amino acids 29 to 420 (392 residues), 425.1 bits, see alignment E=1.7e-131 PF03958: Secretin_N" amino acids 128 to 190 (63 residues), 48.5 bits, see alignment E=8.4e-17 PF00263: Secretin" amino acids 260 to 420 (161 residues), 164.4 bits, see alignment E=1.9e-52

Best Hits

Swiss-Prot: 53% identical to HOFQ_ECOLI: DNA utilization protein HofQ (hofQ) from Escherichia coli (strain K12)

KEGG orthology group: K02507, protein transport protein HofQ (inferred from 92% identity to pwa:Pecwa_4062)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>HER17_RS01770 DNA uptake porin HofQ (Pectobacterium carotovorum WPP14)
MNMKMLCRVAAWSWLLLLTAPFQASAESSVSMAFEDSPIPRVLQALADHQQLNVVIAPGV
TGNLSLRLADIPWEQALDIVLRMGKLSVERNGNVLMVFPADHLESLQKERDEHAAEQAQK
LPLHNISVALQYADATEVAASVQAQRGTLLSTRGSVTVDKRTNTLLIRDTEEALTQLEPW
VKELDLPLAQVQLAAHIVTISSEHLQALGVNWGLGEGDVANKALRLNNFNVGLPVDTPAV
NAGFHLARLNGRLLDLELMALEQESQVEIIASPRLFTAHQQTASIKQGTEIPYQVSSGAS
GSTSIEFKEAVLGMEVTPDILRAGRITLNLKISQNMPGQTIKQGDNGEALAIDKQEIQTQ
VTVADGETIVLGGIFQQQKKNSDRQVPLLGEVPVFGHLFRNHTQQHTRRELVIFITPTLI
PASS