Protein Info for HER17_RS01460 in Pectobacterium carotovorum WPP14

Annotation: GntP family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 110 to 137 (28 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 237 to 264 (28 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 369 to 387 (19 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 433 to 457 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 13 to 455 (443 residues), 392.9 bits, see alignment E=1.8e-121 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 13 to 456 (444 residues), 356.8 bits, see alignment E=9.7e-111 PF03600: CitMHS" amino acids 27 to 389 (363 residues), 59.1 bits, see alignment E=4.1e-20

Best Hits

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 99% identity to eca:ECA4158)

Predicted SEED Role

"Low-affinity gluconate/H+ symporter GntU" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>HER17_RS01460 GntP family permease (Pectobacterium carotovorum WPP14)
MTEITSAYSASVLLTIAAGAVALLLVLIMRFRVHAFLALTLVSLITALATKTPFEKLVPT
LLSGFGSTLASVALLVGLGAMIGRLLEVTGGANVLADTLINKFGEKRAPFALGLASLLFG
FPIFFDAGLIVMLPIIFSVAKRFGGSTLTYAFPAAGAFAVMHALLPPHPGPVAASELLGA
NIGLLVLVGAVIAYPTWYFGGYLFGLWAGKKFHLPLPSTFLTEVKADEQHTPPPFSVVMW
VLLLPLILIFLDTGLNTLTVMGVISGDSGLVQFLRMLGKTPIALLITVLFAMIMFSGQHS
RRHLEKICEGALGPVCSIILVTGAGGMFGGVLRSSGIGDALSGALADTGMPVIVAAFVVS
AALRVAQGSATVALTTTAALMAPAVAATPGLSQFDLCFIVVAIAGGATVLSHVNDSGFWL
VGRFLEMDEKTTLKTWTVMETLLGTIAFLIALVGSIFL