Protein Info for HER17_RS01380 in Pectobacterium carotovorum WPP14

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 261 (254 residues), 329.7 bits, see alignment E=6.3e-103 PF00892: EamA" amino acids 9 to 142 (134 residues), 68.6 bits, see alignment E=3.2e-23

Best Hits

Swiss-Prot: 75% identical to RARD_SALTY: Protein RarD (rarD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 96% identity to pwa:Pecwa_4157)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>HER17_RS01380 EamA family transporter RarD (Pectobacterium carotovorum WPP14)
MNAQQTREGIFFALAAYFIWGIAPVYFKLLEHVPPNEILTHRIIWSFFFMLILLTIGRKW
RQVSLACRNVKHLFLLALTAVLIGGNWLLYIWAVNNHHMLEASLGYFINPLVNVMLGMIF
LGERFRRLQWLAVLLAVTGVLVQLWTFGSLPIIALGLAFSFALYGLLRKKIGIDGQTGML
IETLWLLPVAVIYLFFIADTPSSHLTANPWSLNLLLLSAGIVTTVPLLFFTSAAMRLRLS
TLGFFQYLGPTIMFMLAVVFYGETFSSDKLVTFGFIWGALALFILDALYTQRKLRRTPAT
TSLPQHDGK