Protein Info for HER17_RS01230 in Pectobacterium carotovorum WPP14

Annotation: adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR00928: adenylosuccinate lyase" amino acids 15 to 443 (429 residues), 372.4 bits, see alignment E=1.5e-115 PF00206: Lyase_1" amino acids 17 to 292 (276 residues), 156.2 bits, see alignment E=1.4e-49 PF10397: ADSL_C" amino acids 365 to 442 (78 residues), 70.6 bits, see alignment E=1.1e-23

Best Hits

Swiss-Prot: 40% identical to PUR8_PYRHO: Adenylosuccinate lyase (purB) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 99% identity to eca:ECA4197)

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.2.2

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>HER17_RS01230 adenylosuccinate lyase (Pectobacterium carotovorum WPP14)
MASHLIDFLLIGNNFGTPEMRGVWSEHNRLTKQVEVEVALALAEGELGVIPLDAAKTIAE
NADASALNVEEIAKDAARMKHSLMPTIAAIQKQCGAAGEFIHYGVTTQDIVDTATVLQLK
QSFDIVVRDTQLLAVELKRLAKKHQHTLMAGRTHGMQALPTTFGFKLAVWLDEFIRHLER
LGEIKERVLVGNINGAICTYASFGEKGPEIERLTLDKLGLNTPNIGWQSARDRFSEYASV
TVLISGTLGKIGNELYNLMRTEINEIEEPFSEGKIGSTTMPHKRNPAALEGLASLTAPLF
KSAALIHESMKVEHERDAMSWRAEWIALPEINIYLSAQLQNALGILRGMSVNEKQMLANL
DLQNGLLLSEKVMFEIGKRLGKQTAHHLVYECSMQAFEQNQSFKSVLLAHPVLSEQVTAA
DLDEWLNPANYVGSAPQKVDDVIRYADNSGLLPA