Protein Info for HER17_RS01060 in Pectobacterium carotovorum WPP14

Annotation: acetolactate synthase 2 catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00118: acetolactate synthase, large subunit, biosynthetic type
  • amino acids 1 to 545 (545 residues), 720.1 bits, E=8.6e-221
• PF02776: TPP_enzyme_N
  • amino acids 1 to 116 (116 residues), 142.6 bits, E=7.3e-46
• PF00205: TPP_enzyme_M
  • amino acids 186 to 321 (136 residues), 157.4 bits, E=2.7e-50
• PF02775: TPP_enzyme_C
  • amino acids 374 to 522 (149 residues), 177.8 bits, E=1.9e-56

Best Hits

Swiss-Prot: 80% identical to ILVG_ECOLI: Acetolactate synthase isozyme 2 large subunit (ilvG) from Escherichia coli (strain K12)

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 98% identity to pct:PC1_4032)

Predicted SEED Role

"Acetolactate synthase large subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (5/5 steps found)
• L-valine biosynthesis (4/4 steps found)
• superpathway of L-threonine metabolism (14/18 steps found)
• pyruvate fermentation to (R)-acetoin I (3/3 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• superpathway of 2,3-butanediol biosynthesis (4/6 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• L-isoleucine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (548 amino acids)

>HER17_RS01060 acetolactate synthase 2 catalytic subunit (Pectobacterium carotovorum WPP14)
MNGAQWVVQALRAQGVETVFGYPGGAIMPVYDALYDGGVKHLLCRHEQGAVMAAIGYARS
TGNVGVCIATSGPGATNLITGLADALLDSVPVVAITGQVGSALIGTDAFQEIDVLGLSLA
CTKHSFLVESLESLPEVMAEAFAIANSGRPGPVLVDIPKDIQLAVGDFTPNFAPVANDVD
FPEQDIAQAYALLAKAQKPVLYVGGGVGIANAVPALREFLSVTDIPSVSTLKGLGAVDAN
HPYYLGMIGMHGTKAANLIVQECDLLIAVGARFDDRVTGKLNAFAPHASVIHMDIDPAEL
SKLRHANVALQGDLNAILPALQQPLNVSAWRQQATMMKAEYPWRYDHPGQAIYAPALLKT
ISERMDVDTVVTTDVGQHQMWAAQHMTFSRPENFITSSGLGTMGFGVPAAVGAQVARPDD
MVICISGDGSFMMNVQELGTIKRKRLPLKIVLLDNQRLGMVRQWQQLFFDERYSETDLSD
NPDFLTLASAFDIPGQRITRKDQIDVALDALFNSEGPYLLHVSIDEYENVWPLVPPGAGN
ETMLDKTK