Protein Info for HER17_RS00955 in Pectobacterium carotovorum WPP14

Annotation: DNA-binding transcriptional regulator OxyR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 3 to 61 (59 residues), 78.5 bits, E=2.9e-26
• PF03466: LysR_substrate
  • amino acids 89 to 293 (205 residues), 185.5 bits, E=8.8e-59

Best Hits

Swiss-Prot: 100% identical to OXYR_PECCC: Hydrogen peroxide-inducible genes activator (oxyR) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 99% identity to eca:ECA4243)

MetaCyc: 90% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Protein Sequence (302 amino acids)

>HER17_RS00955 DNA-binding transcriptional regulator OxyR (Pectobacterium carotovorum WPP14)
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQA
GLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPYLLPQIIPMLHRTFPKL
EMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPLFDEPMKLAIYQDHPWANRER
VAMSDLAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRATSLETLRNMVAAGSGITLL
PALSVPRERERDGVCYLPCYKPEPKRTIALVYRPGSPLRGRYEQLADTIREHMQGYMETL
SK