Protein Info for HER17_RS00935 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 258 (175 residues), 61.5 bits, see alignment E=4.5e-21

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to eca:ECA4247)

Predicted SEED Role

"FIG00731890: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>HER17_RS00935 ABC transporter permease subunit (Pectobacterium carotovorum WPP14)
MKNVLWWIPRMLILGTLIFLIFGPLANLLLWSVAEKWFYPHLLPNEWGFAFWKRVFSPRG
VAWEALGNSVLVAVFTVLASLSLAIPAGYALARLPLPARGLILLVFLIPQAFPNLTVYVN
IARLFYQWGLNGTLLGVVLVHTVHGLVFAVWIASAAFSAVGREMEQAARSIGAGPWRAFV
DITLPLAMPGLMASAIFVFLESLDEFTGSYFVGAPDVQMMPLLLYTAGAGGNYQIASITA
LVLLIPSVLFMLVVERFLKADVMARIGK