Protein Info for HER17_RS00930 in Pectobacterium carotovorum WPP14

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 62 to 89 (28 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 202 to 226 (25 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 270 (190 residues), 49.5 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: None (inferred from 98% identity to pct:PC1_0181)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>HER17_RS00930 sugar ABC transporter permease (Pectobacterium carotovorum WPP14)
MLQVSQFSSRLAGIALVLPALAVVAVCFITPLGLSVGGAFVSQNGVGIDNFVTALTLYLP
DILFTLLIVSLATLLIGLLSVMIGGYLTLGESPRMVALLRWVYRWPLFIPFIVTGQILRT
FLAKNGWLNGALDTLGIVDLVSASNWLDWRGIVFAFVWKQTPFVALLVAGAMASLDRTMI
ESARNLGASRLRILCEIVVPQVGQTLLTGLILSFVTMMSVLSVPMMINAQSPTMLTANIA
FRINAYGDYGVANALGVISLLMTGLFAVIYLRLNMREKA