Protein Info for HER17_RS00890 in Pectobacterium carotovorum WPP14

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 184 to 217 (34 residues), see Phobius details amino acids 219 to 219 (1 residues), see Phobius details amino acids 242 to 272 (31 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details PF01032: FecCD" amino acids 19 to 332 (314 residues), 266.6 bits, see alignment E=1.3e-83

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 97% identity to pwa:Pecwa_0185)

Predicted SEED Role

"ABC transporter (iron.B12.siderophore.hemin) , permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>HER17_RS00890 iron ABC transporter permease (Pectobacterium carotovorum WPP14)
MNPTSSRYAATVVIALLILVGLMLLNIATGSTTIPLTQVASVLGLSSADVSPMTSRIILE
LRIPRSLLAALCGAGLAMVGAFLQTATRNDLADPFLFGLSAGASAGAVAVITRFGEQLGD
WALPMAAFCGGILSAVAVTVLFLLQQARGAERLIICGLAISFLFGALTNYLVFSGDQRAA
SSILFWSLGGLGLARWDTLPFAVFSVLLLFGLTALRWRALDALLAGGQTAASMGVNLSRV
RVEIFICCAFATSLLVALTGVIGFIGLMIPHLARPLSGVLHKKLLPLTAILGAILLCGGD
WLSRQLLAPQELPIGIITAGLGGIFVLGMLVKRQQG