Protein Info for HER17_RS00860 in Pectobacterium carotovorum WPP14

Annotation: cell division protein FtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details TIGR02223: cell division protein FtsN" amino acids 1 to 285 (285 residues), 254.4 bits, see alignment E=8.9e-80 PF05036: SPOR" amino acids 218 to 284 (67 residues), 62.6 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K03591, cell division protein FtsN (inferred from 95% identity to eca:ECA4260)

Predicted SEED Role

"Cell division protein FtsN" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>HER17_RS00860 cell division protein FtsN (Pectobacterium carotovorum WPP14)
MAQRDYVSRGRSSGTRRKTTNGRKKGKASGASKTMIALAVAVLVTFAGGLYFIAHNKPDD
SPVLPHQNVGKGNGLPPKPEERWRYIKELENRQLGVTTPTEPSAGGEIQSPVQLTDEQRQ
LLEQMQSDMRRQPTQLSEVPYNDQTQVPRSQVTIKPPTQSMQQPPVVTTQPTTRAPVVTQ
TTPVVPRQDIPRQEAPKQEAPKQQPVKQPEAPKAEKTQRWAIQCGSFKTMDPAESVRAQL
AFAGIESRITSNGGWNRIMLGPYNNRAAADSMIQRLKGAGASNCIPLASGG