Protein Info for HER17_RS00775 in Pectobacterium carotovorum WPP14
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to SSUB_BACLD: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
KEGG orthology group: None (inferred from 94% identity to pwa:Pecwa_4335)Predicted SEED Role
"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>HER17_RS00775 ABC transporter ATP-binding protein (Pectobacterium carotovorum WPP14) MSLHFQHITKHFTVNGAPLTVLQDIDLSLHAGELVAVIGASGCGKSTLLRLAAGIDTTER GRILIGERTVQGIPDDVSLVFQEPRLFPWLTVTDNIRLGMLNLDLSPAEVTHRIAHYLQM MGLEGFADAWPHQLSGGMAQRVAIARGLVSTPRILLLDEPFGALDALTKQQLQERLAEIR QQTDLTILLVTHDVEEAVFLADRVVVMSPRPGRISAILPVTLTYPRDRTSPTLLEQRQAV SQALHQADAVAA