Protein Info for HER17_RS00720 in Pectobacterium carotovorum WPP14

Annotation: CDF family cation-efflux transporter FieF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 14 to 287 (274 residues), 226 bits, see alignment E=2.9e-71 PF01545: Cation_efflux" amino acids 16 to 206 (191 residues), 156.7 bits, see alignment E=6.4e-50 PF16916: ZT_dimer" amino acids 210 to 287 (78 residues), 89.6 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 99% identical to FIEF_PECCP: Cation-efflux pump FieF (fieF) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K13283, ferrous-iron efflux pump FieF (inferred from 99% identity to pct:PC1_0139)

MetaCyc: 70% identical to Zn2+/Fe2+/Cd2+ exporter (Escherichia coli K-12 substr. MG1655)
RXN0-6; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>HER17_RS00720 CDF family cation-efflux transporter FieF (Pectobacterium carotovorum WPP14)
MNPHYARLVTLAAVSATAVALVLFIMKVFAWWHTGSVSLLASLVDSLVDIAASLVNLLVV
RYSLQPADTEHAFGHGKAESLAALAQSMFISGSALFLILTGLQHSLEPQTLHAPEVGMWV
TLIALVATLLLVSFQRWVVKRTHSQAVRADMLHYQSDLLMNGAILVALALSWKGITRADS
LFALGIGGYILYSALRMGYDAVQSLLDRALPEDEHRAIAEVIVNWPGIRGAHALRTRRSG
PTRFIQLHLEMDDALPLVQAHQIADDLEQALREQFPGADIIIHQDPVSAVPENQRGRLTA