Protein Info for HER17_RS00545 in Pectobacterium carotovorum WPP14

Annotation: GntP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 5 to 22 (18 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 99 to 131 (33 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 310 to 329 (20 residues), see Phobius details amino acids 349 to 378 (30 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details amino acids 427 to 451 (25 residues), see Phobius details PF02447: GntP_permease" amino acids 6 to 450 (445 residues), 462.4 bits, see alignment E=7.5e-143 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 7 to 451 (445 residues), 340.9 bits, see alignment E=6.5e-106

Best Hits

Swiss-Prot: 73% identical to YGBN_ECOLI: Inner membrane permease YgbN (ygbN) from Escherichia coli (strain K12)

KEGG orthology group: K03299, gluconate:H+ symporter, GntP family (inferred from 98% identity to eca:ECA4331)

Predicted SEED Role

"Gluconate permease" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>HER17_RS00545 GntP family transporter (Pectobacterium carotovorum WPP14)
MATSLLLCIAIAGVLLLLLMVIKFKIQPFVALLVVSLLVALATGIPTGEAMKVITSGMGG
ILGSVAIIIGLGAMLGRMIEVSGGAESLAHRFAQLMGPGLMVAALTIAAFILGIPVFFDV
GFIILAPIIYGFAKVAKVSPIKFGLPVAGVMLTVHVALPPHPGPVAAAGLLNADIGWLTI
IGLLVSIPVGIISYWAAKAMNRRKYALSVEVLEQLQLAKPEDTTLDTAPVSAPSAGLIAA
LIAIPIAIIMLGTVSATILPAGHPVRNVMSLVGSPAVALLIALGLAFWLIALRRGWSLEK
ASGVMGDAMPAAAMVIMVTGAGGVFGKVLVESGIGKALADTLTSIHLPLVPAAFILSLAL
RASQGSATVAILTTCGLLSEAVSGLNQMQLVLVTLSACFGGLGLSHVNDSGFWIVTKYLG
LSVADGLRTWTVLTTLLGLAGFLFTWALWLVL