Protein Info for HER17_RS00530 in Pectobacterium carotovorum WPP14

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 11 to 185 (175 residues), 73.3 bits, see alignment E=1.9e-24 PF00015: MCPsignal" amino acids 327 to 484 (158 residues), 180.2 bits, see alignment E=3.4e-57

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 93% identity to pct:PC1_0111)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>HER17_RS00530 methyl-accepting chemotaxis protein (Pectobacterium carotovorum WPP14)
MNLIKNSSLGKMLGTGFTLVIAIGFLVAVFGRIQLDKLGENIQLLSQVRITNLLMMQEFK
DNINTNAIAIRNLTMLEDSQQMQGEKARIEEMISRNNALLSKIHDAAVEQRAQELVAVLE
RVRPAYSSSYKDAIALATANKNSEAQHLLLTDVRVKQDAVFQALNDMVNWQEKLTVEIAE
QSLKNATSAGTLMVIIALLSVVLGAMISWWITRAIKRQLGGEPAYTLEVTRQVAQGNLAV
AIELRDGDTTSVLAAMEDMRQNLSNLVGQVHQSSESIATGATQIAMGNTDLSQRTEEQAA
NLQETAASMEQMNTTVKQNAATVRTATELAHSASTTAQKGGDAVNNVVRTMEDITASSRK
IGDIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSASAAREIKDL
ISVSVSNVEMGEKLVNDAGITIKDIVEKSQQVANLLNEIGLTTHEQEQGVSQVNDAVNQL
DQVTQQNAALVEESASAADSLSEQARTLLELMGVFKISGVQTPAPRLTSQTKKPTAPRLA
LAGKSGSTSRDNWETF