Protein Info for HER17_RS00395 in Pectobacterium carotovorum WPP14

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details PF17154: GAPES3" amino acids 25 to 144 (120 residues), 187.4 bits, see alignment E=7.3e-60

Best Hits

KEGG orthology group: None (inferred from 92% identity to pct:PC1_0082)

Predicted SEED Role

"FIG00905245: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>HER17_RS00395 diguanylate cyclase (Pectobacterium carotovorum WPP14)
MTAVSAVALVTISLFIVIQLFHFVHQRREDYAKQLESIAYSVRQPLTDAVLQGEVQRAGN
ILDSLLPVAFLSRADVLLPDDFQTLHANFPKERPVPDWIARVFKLPIRISIPLYSPPQTQ
YSAPLAHLVLQADSYRMYQFIVSTFSTMLATYLLLALIMSIAITWCINRLLIHPLRGIIV
ELQNLPPDDMLHRQLTLPPWHQDDELGALVRSYNRNQQLLAQSLSAGTEGAGLPDKAHFM
RRLEQRLADATPFSLLVFGLDSSASKQGKVDMLAKQLSAAIEEQNNEAGLIYLARLDCDE
FAIIGKPLQSAGQAQDWAQNVMLAINSPFLPADSQPARAVSVGILTITDPRPEEAALLLS
QARFAMQLARRDKKCGIHQFTVPS