Protein Info for HER17_RS00105 in Pectobacterium carotovorum WPP14

Annotation: nucleoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 6 to 303 (298 residues), 287.3 bits, E=9.5e-90

Best Hits

KEGG orthology group: None (inferred from 92% identity to pct:PC1_0018)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (8/18 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.1

Use Curated BLAST to search for 3.2.2.1

Protein Sequence (329 amino acids)

>HER17_RS00105 nucleoside hydrolase (Pectobacterium carotovorum WPP14)
MVRERIIIDTDPGVDDAIAIWLALASPELDVLGITVVAGNVPLAATLPNACNVVGVTGRT
DVPIFAGASRPLIRDQVFGKYAHIGKFSSEWVPESTLSPEEEHAVDFLVRMTRQAAADNN
PITICSLGPLTNLALALCFHPDVARGIKQIVSMSCAFTAMGNRVPWADFNVYADPHAAEI
VFSSGVPIVIMPLDVTFQALIQTEQVDDIARSGGAPGKAMAALLRMFDRSEVERFGREGG
PIHDATVIAWLLKPELFKSKRAHLGVEVSGKTAGYAFADFYHKLSEPENALIMREINEQG
FLELIADRLRRYGSEAINDVKAINGSEER