Protein Info for HEPCGN_27355 in Escherichia coli ECOR38

Annotation: protein disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details amino acids 29 to 31 (3 residues), see Phobius details transmembrane" amino acids 14 to 28 (15 residues), see Phobius details PF08534: Redoxin" amino acids 43 to 148 (106 residues), 54.1 bits, see alignment E=3.1e-18 PF00578: AhpC-TSA" amino acids 43 to 147 (105 residues), 52.4 bits, see alignment E=1e-17 PF13905: Thioredoxin_8" amino acids 60 to 143 (84 residues), 36.6 bits, see alignment E=9.9e-13

Best Hits

Swiss-Prot: 42% identical to THIX_HAEIN: Thioredoxin-like protein HI_1115 (HI_1115) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 99% identity to cko:CKO_02060)

Predicted SEED Role

"Membrane protein, suppressor for copper-sensitivity ScsD" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>HEPCGN_27355 protein disulfide oxidoreductase (Escherichia coli ECOR38)
MLSKLRRWLREGAILLVLLAGVIILLDVWRSPQMPAMFDSTPLHTLDGETVTLASISEER
PVLLYFWASWCGICRFTTPDVARLQSEGESVMTIALRSGNDGEVSRWLSRKRVTFPVVND
SGGEISRNWEISVTPTLVVVSKGQVVTTTSGWTSYWGMKLRLWRAAMF