Protein Info for HEPCGN_27350 in Escherichia coli ECOR38

Name: nqrC
Annotation: Na(+)-translocating NADH-quinone reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details TIGR01938: NADH:ubiquinone oxidoreductase, Na(+)-translocating, C subunit" amino acids 5 to 242 (238 residues), 180.5 bits, see alignment E=2.3e-57 PF04205: FMN_bind" amino acids 140 to 231 (92 residues), 42.9 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 37% identical to NQRC_HAEIN: Na(+)-translocating NADH-quinone reductase subunit C (nqrC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00348, Na+-transporting NADH:ubiquinone oxidoreductase subunit C [EC: 1.6.5.-] (inferred from 100% identity to eum:p1ECUMN_0045)

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit C (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>HEPCGN_27350 Na(+)-translocating NADH-quinone reductase subunit C (Escherichia coli ECOR38)
MRKGKIIVASMMVLCVLIFVAAAAWFMLFQGEMTEPTEEEKQAAILHAAGLMKSETQDKK
SVETLYHCYIIQRHVNLDSGELVAGSSADTARQKCEKLAPERDPAQVRQRCTVADVFFVK
DKNNEIQQVIIPVTGKGAKSMMHAFLALGLDGRTVRNLYYYQQRETPFLGARVEDANWRK
QWPGKRLLDNSGHPALKIVQDKPEHADEYTVDGISGATLTSTGVEKSINYWMGPQGYGQF
LQRLASDRNNLNL