Protein Info for HEPCGN_26495 in Escherichia coli ECOR38

Name: dosC
Annotation: diguanylate cyclase DosC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF11563: Protoglobin" amino acids 26 to 156 (131 residues), 38.9 bits, see alignment E=1.4e-13 PF21118: DosC_2nd" amino acids 180 to 289 (110 residues), 163.8 bits, see alignment E=2.2e-52 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 297 to 455 (159 residues), 177 bits, see alignment E=1.3e-56 PF00990: GGDEF" amino acids 297 to 452 (156 residues), 171.3 bits, see alignment E=2.1e-54

Best Hits

Swiss-Prot: 100% identical to DOSC_SHIBS: Diguanylate cyclase DosC (dosC) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 99% identity to eco:b1490)

MetaCyc: 99% identical to diguanylate cyclase DosC (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>HEPCGN_26495 diguanylate cyclase DosC (Escherichia coli ECOR38)
MEMYFKRMKDEWTGLVEQADPLIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQ
VERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILY
PVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDENYRIFSLLENAEE
EKERQIASLLSWEIDIIYKVLLDSDLGSSLPLSQADFGLWFNHKGRHYFSGIAEVGHISR
LIQDFDGIFNQTMRNTRNLNNRSLRVKFLLQIRNTVSQIITLLRELFEEVSRHEVGMDVL
TKLLNRRFLPTIFKREIAHANRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAF
YDNVRSSDYVFRYGGDEFIIVLTEASENETLRTAERIRSRVEKTKLKAANGEDIALSLSI
GAAMFNGHPDYERLIQIADEALYIAKRRGRNRVELWKASL