Protein Info for HEPCGN_26375 in Escherichia coli ECOR38

Name: narU
Annotation: nitrate/nitrite transporter NarU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 36 to 59 (24 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 346 to 374 (29 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details TIGR00886: nitrite transporter" amino acids 34 to 415 (382 residues), 340.5 bits, see alignment E=6.2e-106 PF07690: MFS_1" amino acids 43 to 373 (331 residues), 47.7 bits, see alignment E=5.6e-17

Best Hits

Swiss-Prot: 100% identical to NARU_ECOLI: Nitrate/nitrite transporter NarU (narU) from Escherichia coli (strain K12)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to eco:b1469)

MetaCyc: 100% identical to nitrate/nitrite transporter NarU (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-239

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>HEPCGN_26375 nitrate/nitrite transporter NarU (Escherichia coli ECOR38)
MALQNEKNSRYLLRDWKPENPAFWENKGKHIARRNLWISVSCLLLAFCVWMLFSAVTVNL
NKIGFNFTTDQLFLLTALPSVSGALLRVPYSFMVPIFGGRRWTVFSTAILIIPCVWLGIA
VQNPNTPFGIFIVIALLCGFAGANFASSMGNISFFFPKAKQGSALGINGGLGNLGVSVMQ
LVAPLVIFVPVFAFLGVNGVPQADGSVMSLANAAWIWVPLLAIATIAAWSGMNDIASSRA
SIADQLPVLQRLHLWLLSLLYLATFGSFIGFSAGFAMLAKTQFPDVNILRLAFFGPFIGA
IARSVGGAISDKFGGVRVTLINFIFMAIFSALLFLTLPGTGSGNFIAFYAVFMGLFLTAG
LGSGSTFQMIAVIFRQITIYRVKMKGGSDEQAQREAVTETAAALGFISAIGAVGGFFIPQ
AFGMSLNMTGSPVGAMKVFLIFYIVCVLLTWLVYGRRKFSQK