Protein Info for HEPCGN_26005 in Escherichia coli ECOR38

Name: ttcA
Annotation: tRNA 2-thiocytidine(32) synthetase TtcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF01171: ATP_bind_3" amino acids 42 to 204 (163 residues), 52.5 bits, see alignment E=2.7e-18

Best Hits

Swiss-Prot: 100% identical to TTCA_ECO7I: tRNA-cytidine(32) 2-sulfurtransferase (ttcA) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K14058, tRNA 2-thiocytidine biosynthesis protein TtcA (inferred from 100% identity to ect:ECIAI39_1695)

MetaCyc: 98% identical to tRNA cytosine32 2-sulfurtransferase TtcA (Escherichia coli K-12 substr. MG1655)
2.8.1.M2 [EC: 2.8.1.M2]

Predicted SEED Role

"tRNA(Cytosine32)-2-thiocytidine synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>HEPCGN_26005 tRNA 2-thiocytidine(32) synthetase TtcA (Escherichia coli ECOR38)
MSKNQEISKKEQYNLNKLQKRLRRNVGEAIADFNMIEEGDRIMVCLSGGKDSYTMLEILR
NLQQSAPINFSLVAVNLDQKQPGFPEHVLPEYLEKLGVEYKIVEENTYGIVKEKIPEGKT
TCSLCSRLRRGILYRTATELGATKIALGHHRDDILQTLFLNMFYGGKMKGMPPKLMSDDG
KHIVIRPLAYCREKDIQRFADAKAFPIIPCNLCGSQPNLQRQVIADMLRDWDKRYPGRIE
TMFSAMQNVVPSHLCDTNLFDFKGITHGSEVVNRGDLAFDREEIPLQPAGWQPEEDENQL
DELRLNVVEVK