Protein Info for HEPCGN_25975 in Escherichia coli ECOR38

Name: dgcM
Annotation: diguanylate cyclase DgcM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR00229: PAS domain S-box protein" amino acids 130 to 249 (120 residues), 45.6 bits, see alignment E=7.1e-16 PF13188: PAS_8" amino acids 130 to 170 (41 residues), 20 bits, see alignment 1e-07 PF08448: PAS_4" amino acids 140 to 244 (105 residues), 33.7 bits, see alignment E=7.7e-12 PF13426: PAS_9" amino acids 148 to 241 (94 residues), 30.2 bits, see alignment E=9.5e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 249 to 408 (160 residues), 148.1 bits, see alignment E=1.9e-47 PF00990: GGDEF" amino acids 253 to 406 (154 residues), 157.3 bits, see alignment E=5.9e-50

Best Hits

Swiss-Prot: 99% identical to DGCM_ECOLI: Diguanylate cyclase DgcM (dgcM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_1691)

MetaCyc: 99% identical to diguanylate cyclase DgcM (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"FIG00638107: hypothetical protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>HEPCGN_25975 diguanylate cyclase DgcM (Escherichia coli ECOR38)
MITHNFNTLDLLTSPVWIVSPFEEQLIYANSAARLLMQNLTFSQLRTGPYSVSSQKELPK
YLSDLQNQHDIIEILTVQRNEEETALSCRLVLRKLTEAEPVIIFEGIEAPATLGLKASRS
ANYQRKKQGFYARFFLTNSAPMLLIDPSRDGQIVDANLAALNFYGYNHETMCQKHTWEIN
MLGRRVMPIMHEISHLPGGHKPLNFVHKLADGSTRHVQTYAGPIEIYGDKLMLCIVHDIT
EQKRLEEQLEHAAHHDAMTGLLNRRQFYHITEPGQMQHLAIAQDYSLLLIDTDRFKHIND
LYGHSKGDEVLCALARTLESCARKGDLVFRWGGEEFVLLLPRTPLDTALSLAETIRVSVA
KVSISGLPRFTVSIGVAHHEGNESIDELFKRVDDALYRAKNDGRNRVLAA