Protein Info for HEPCGN_25890 in Escherichia coli ECOR38

Name: tpx
Annotation: thiol peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF08534: Redoxin" amino acids 20 to 163 (144 residues), 134.7 bits, see alignment E=2.2e-43 PF00578: AhpC-TSA" amino acids 22 to 145 (124 residues), 62.7 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 99% identical to TPX_ECOL6: Thiol peroxidase (tpx) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11065, thiol peroxidase, atypical 2-Cys peroxiredoxin [EC: 1.11.1.15] (inferred from 99% identity to eco:b1324)

MetaCyc: 99% identical to lipid hydroperoxide peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Tpx-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>HEPCGN_25890 thiol peroxidase (Escherichia coli ECOR38)
MSQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLSQFAGKRKVLNIFPSIDTGV
CAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGV
AIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA