Protein Info for HEPCGN_25650 in Escherichia coli ECOR38

Name: pyrF
Annotation: orotidine-5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00215: OMPdecase
  • amino acids 36 to 257 (222 residues), 233.5 bits, E=1.4e-73
• TIGR01740: orotidine 5'-phosphate decarboxylase
  • amino acids 37 to 257 (221 residues), 183.3 bits, E=2.5e-58

Best Hits

Swiss-Prot: 100% identical to PYRF_ECO57: Orotidine 5'-phosphate decarboxylase (pyrF) from Escherichia coli O157:H7

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to ecf:ECH74115_1916)

MetaCyc: 98% identical to orotidine-5'-phosphate decarboxylase (Escherichia coli K-12 substr. MG1655)
Orotidine-5'-phosphate decarboxylase. [EC: 4.1.1.23]

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Protein Sequence (265 amino acids)

>HEPCGN_25650 orotidine-5'-phosphate decarboxylase (Escherichia coli ECOR38)
MLAVYLFRATSGAHHQEGLVMTLTASSSSRAVTNSPVVVALDYHNRDAALAFVDKIDPRD
CRLKVGKEMFTLFGPQFVRELQQRGFDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHA
SGGARMMTAAREALVPFGKDAPLLIAVTVLTSMEASDLADLGVTLSPADYAERLAALTQK
CGLDGVVCSAQEAVRFKQVFGQEFKLVTPGIRPQGSEAGDQRRIMTPEQALAAGVDYMVI
GRPVTQSVDPAQTLKAINASLQRSA