Protein Info for HEPCGN_25410 in Escherichia coli ECOR38

Annotation: phage tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF06763: Minor_tail_Z" amino acids 3 to 177 (175 residues), 198.8 bits, see alignment E=3.9e-63

Best Hits

Swiss-Prot: 51% identical to COMPL_BPN15: Tail completion protein (gene) from Escherichia phage N15

KEGG orthology group: None (inferred from 95% identity to eok:G2583_1929)

Predicted SEED Role

"Minor tail protein Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>HEPCGN_25410 phage tail protein (Escherichia coli ECOR38)
MAIKGLDQAIDNLSRVRKNAIPAASAMTINRVATTAINQSSSQVARETKVRRKLVKERSR
LKRATVRNPNARIIVNRGDLPVIKLGIRMLGRRPNSILKAGQHRYQRAFIQRLKNGRWHV
MQRVAGKNRYPIDVVKIPMAAPLKQAFDENIDRIRRERLPKELAYALKQQLRIAIKR