Protein Info for HEPCGN_24905 in Escherichia coli ECOR38

Name: lolB
Annotation: lipoprotein insertase outer membrane protein LolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00548: outer membrane lipoprotein LolB
  • amino acids 5 to 206 (202 residues), 326.9 bits, E=2.1e-102
• PF03550: LolB
  • amino acids 51 to 204 (154 residues), 159.7 bits, E=2.7e-51

Best Hits

Swiss-Prot: 100% identical to LOLB_ECO7I: Outer-membrane lipoprotein LolB (lolB) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 99% identity to eco:b1209)

MetaCyc: 99% identical to outer membrane lipoprotein LolB (Escherichia coli K-12 substr. MG1655)
RXN-22553

Predicted SEED Role

"Outer membrane lipoprotein LolB"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (6/7 steps found)

Protein Sequence (207 amino acids)

>HEPCGN_24905 lipoprotein insertase outer membrane protein LolB (Escherichia coli ECOR38)
MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGSFAY
ISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTSDDAEE
MIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKT
QPAMPANMELTDGGQRIKLKMDNWIVK