Protein Info for HEPCGN_24900 in Escherichia coli ECOR38

Name: ispE
Annotation: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 1 to 282 (282 residues), 414.9 bits, E=1.1e-128
• PF00288: GHMP_kinases_N
  • amino acids 92 to 148 (57 residues), 57.4 bits, E=1.6e-19
• PF08544: GHMP_kinases_C
  • amino acids 197 to 265 (69 residues), 37.1 bits, E=3.5e-13

Best Hits

Swiss-Prot: 100% identical to ISPE_ECOSM: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 99% identity to eco:b1208)

MetaCyc: 99% identical to 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Escherichia coli K-12 substr. MG1655)
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase. [EC: 2.7.1.148]

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• isoprene biosynthesis I (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Protein Sequence (283 amino acids)

>HEPCGN_24900 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Escherichia coli ECOR38)
MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTINIELRDDGDIRLLTPVEGV
EHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIP
TPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGT
GACVFAEFDTESEARQVLEQAPEWLNGFVAKGVNLSPLHRAML