Protein Info for HEPCGN_24710 in Escherichia coli ECOR38

Annotation: ISL3-like element ISEc53 family transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF14690: zf-ISL3" amino acids 44 to 86 (43 residues), 39.3 bits, see alignment 9.8e-14 PF13542: HTH_Tnp_ISL3" amino acids 92 to 141 (50 residues), 43 bits, see alignment 3.8e-15 PF01610: DDE_Tnp_ISL3" amino acids 159 to 393 (235 residues), 198.1 bits, see alignment E=3.1e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to eci:UTI89_P067)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>HEPCGN_24710 ISL3-like element ISEc53 family transposase (Escherichia coli ECOR38)
MDEKSLYAHILNLTAPWQVKSLTLDENAGSVTVTVGIAENTQLTCPTCRKSCSVHDHRHR
KWRHLDTCQFMTLVEADVPRVMCPEHGCQTLPVPWAGSGSRYTLLFESFVLSWLKISTVD
AVRKQLKLSWNAVDGIMTRAVKRGLSRIKKPLSVRHMNVDEVAFKKGHRYITVVSDRDGR
ALALTDDRGTESLASYLRSLTDSQLLAIKTLSMDMNAGYIRAARIHLPNAVEKIAFDRFH
VAKQLGEVVDKTRQNEHPHLPVESRRQAKGTRFLWQYSDKWMTESRQEKLMWLREQMQQT
SQCWTLKELAKNIWDRPWSTERRNDWLQWISLASECDVPMMKNAAKTIKKRLYGILNAMR
HRVSNGNAEALNSKIRLLRIKARGYRNRERFKLGVMFHYGKLNMAY