Protein Info for HEPCGN_24445 in Escherichia coli ECOR38

Annotation: phage tail protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF04984: Phage_sheath_1" amino acids 182 to 358 (177 residues), 101.4 bits, see alignment E=5.2e-33 PF17482: Phage_sheath_1C" amino acids 367 to 464 (98 residues), 68.1 bits, see alignment E=6.2e-23

Best Hits

Swiss-Prot: 76% identical to TSP_BPBMU: Tail sheath protein (BcepMu39) from Burkholderia phage BcepMu (isolate -/United States/Summer/2002)

KEGG orthology group: K06907, (no description) (inferred from 100% identity to ect:ECIAI39_1961)

Predicted SEED Role

"Phage tail sheath monomer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (475 amino acids)

>HEPCGN_24445 phage tail protein (Escherichia coli ECOR38)
MAANYLHGPETIEVENGARPVKTVKSAVIGLIGTAPMGDVNTLVQCLSEKDAAAFGSQFT
GFTIPQALDAIYDHGAGTVLVINVLDPAKHKTAIEDEVVTFDKSTGQARLAHPVVANVVV
KNSEGSTTHTANTDYRVDAQAGVLTNLGKAIEAGGSVKVSYEYADPSKVTAADIIGGVNS
AGNRTGMKLLNDSFNLYGYFAKILIAPVFCTQKSVAVELIAMAEKLGAVTYIDAPVGTTF
AQALAGRGPEGTINFNTSSDRVRLCYPHVKVYDPVTNTERLEPLSQRAAGLRARVDLDKG
YWWSSSNQEILGITGVERQLSAMIDDPQSEVNLLNEQGITTVFSSYGSGLRLWGNRTAAW
PTVTHMRNFENVRRTGDVINESIRYFSQQYIDMPITQALIDALTESVNAYGRKMTGDGAV
LGFRCWFDPARNPETELAAGHLLLSYKYTPPPPLERLTFETEITSEYLLTLKGGN