Protein Info for HEPCGN_24050 in Escherichia coli ECOR38

Annotation: Inner membrane protein YcfZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 182 to 202 (21 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details

Best Hits

Swiss-Prot: 88% identical to YCFZ_ECOLI: Inner membrane protein YcfZ (ycfZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ecc:c1396)

Predicted SEED Role

"putative factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>HEPCGN_24050 Inner membrane protein YcfZ (Escherichia coli ECOR38)
MKKIMILLSLLMFLPLTAISKPLIPIMKTLFTDVTGTVPDAEEIAHKAELFRQQTGVVPF
IVVLPDINNEASLRQNGKAMLAHAASSMSNVKGSVLLLFTTREPRLIMITNGQVESSMDD
KHLGLLVENHTLAYLHADLWYQGINNALAVLQAQILKQPTPPLTYYPHLGQQHENDPPGS
TTTLGLFAWAVAFIVFAAFFNYTTRLYYALKFAVAMAVANMGYQALCLYIDNSFAITRIS
PLWAGLIGVCTFIAALLWTSKR