Protein Info for HEPCGN_23895 in Escherichia coli ECOR38

Name: fabH
Annotation: beta-ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 1 to 317 (317 residues), 501.4 bits, E=4.8e-155
• PF08545: ACP_syn_III
  • amino acids 106 to 183 (78 residues), 101 bits, E=2.7e-33
• PF08541: ACP_syn_III_C
  • amino acids 228 to 317 (90 residues), 127.3 bits, E=2.2e-41

Best Hits

Swiss-Prot: 100% identical to FABH_ECOLI: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Escherichia coli (strain K12)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to eco:b1091)

MetaCyc: 100% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• fatty acid biosynthesis initiation (mitochondria) (3/4 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Protein Sequence (317 amino acids)

>HEPCGN_23895 beta-ketoacyl-ACP synthase III (Escherichia coli ECOR38)
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAAT
RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS
VADQYVKSGAVKYALVVGSDVLARTCNPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH
ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW
LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL
LEAFGGGFTWGSALVRF