Protein Info for HEPCGN_23890 in Escherichia coli ECOR38

Name: plsX
Annotation: phosphate acyltransferase PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02504: FA_synthesis
  • amino acids 1 to 321 (321 residues), 430.7 bits, E=1.7e-133
• TIGR00182: fatty acid/phospholipid synthesis protein PlsX
  • amino acids 1 to 335 (335 residues), 484 bits, E=1.2e-149

Best Hits

Swiss-Prot: 100% identical to PLSX_ECO8A: Phosphate acyltransferase (plsX) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to eco:b1090)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (12/12 steps found)
• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Protein Sequence (346 amino acids)

>HEPCGN_23890 phosphate acyltransferase PlsX (Escherichia coli ECOR38)
MGGDFGPSVTVPAALQALNSNSQLTLLLVGNPDAITPLLAKADFEQRSRLQIIPAQSVIA
SDARPSQAIRASRGSSMRVALELVKEGRAQACVSAGNTGALMGLAKLLLKPLEGIERPAL
VTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAIMGSVLAEEVVEIPNPRVALLNIGEEEV
KGLDSIRDASAVLKTIPSINYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFL
SLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHLNPDQYNGACLLGLRGTVIKSHGAANQ
RAFAVAIEQAVQAVQRQVPQRIAARLESVYPAGFELLDGGKSGTLR